DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajb12

DIOPT Version :10

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001013929.1 Gene:Dnajb12 / 294513 RGDID:1359677 Length:378 Species:Rattus norvegicus


Alignment Length:106 Identity:46/106 - (43%)
Similarity:63/106 - (59%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDR 88
            :|:|:||.|.::|:..::|||||:||.:.||||| ..|.|:..|:.:|.||.|||||:|||.||:
  Rat   110 KDYYEILGVSRSASDEDLKKAYRKLALKFHPDKN-HAPGATEAFKAIGTAYAVLSNPEKRKQYDQ 173

  Fly    89 CGEECLKKEGMMDHG---GDPFSSFFGD------FGFHFGG 120
            .|::   |.....||   ||....|..|      |...|||
  Rat   174 FGDD---KNQAARHGHSHGDFHRGFEADISPEDLFNMFFGG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 46/105 (44%)
Dnajb12NP_001013929.1 DnaJ_bact 111..>237 CDD:274090 46/105 (44%)
DUF1977 269..367 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.