DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and SPBC1347.05c

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_596697.3 Gene:SPBC1347.05c / 2540021 PomBaseID:SPBC1347.05c Length:398 Species:Schizosaccharomyces pombe


Alignment Length:374 Identity:111/374 - (29%)
Similarity:177/374 - (47%) Gaps:70/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLS 78
            |:.::...:..|:|:||.|.|:|:.:|::||||:|.|:.|||||..:.:|..||.::..|:||||
pombe    13 LVCIQAVVSAADYYQILGVSKDASESEIRKAYRQLTKQWHPDKNPGNEEAQEKFIEINKAHEVLS 77

  Fly    79 NPDKRKTYDRCGEECLKKEGMMDHGG------------DPFSSFFGDFGFHFGGDGQQQDAPRGA 131
            :|::||.||..|||.|..:.....||            |||...|.:.   |||..:|....||.
pombe    78 DPEQRKIYDAYGEEGLNGQPGGPGGGPGEGFPGGGFGFDPFGDIFDNI---FGGRRRQNAVRRGP 139

  Fly   132 DIVMDLYVSLEELYSGN--FVEI-----------------------VRNKPVTKPASGTRKCNCR 171
            .:...:.:.|...|:|.  .:||                       :.:.||. ..||.|     
pombe   140 SMEQIVQIHLSSFYTGGSFTLEIPVKRTCSVCSGQGFNPKYSADKAIESCPVC-GGSGFR----- 198

  Fly   172 QEMVTRNLGPGRFQMIQ----------QTVCDECPNVK---LVNEERTLEIEVEQGMVDGQETRF 223
              ::...:.||..|.::          :|:..:||..|   :.....:.:|:|..|..:|....|
pombe   199 --VIEHMIAPGFRQQMRMPCNACNGNGRTIKHKCPRCKGERVAEVVESFDIKVPAGAPEGYRIGF 261

  Fly   224 VAEGEPHIDGEPGDLIVRVQQMPHP-RFLRKNDDLYTNVTISLQDALVG-FSMEIKHLDGHLVPV 286
            ..:.:.....|.||:||.::..... .:.||::|||...|||:::||:| :..:|:.|||..:.|
pombe   262 RGKADEIPGMEAGDIIVILEAAGGDYGWTRKDNDLYRKETISVREALLGNWKRKIQKLDGSFMEV 326

  Fly   287 TRE--KVTWPGARIRKKGEGMP--NFENNNLT---GNLYITFDVEFPKK 328
            .|.  :|..||...|.|.:|||  |......|   |:.||.::|:||||
pombe   327 KRSAGEVVHPGETERVKNQGMPIYNLHKGKTTSAHGSAYIEWEVKFPKK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 110/366 (30%)
DnaJ 25..87 CDD:278647 30/61 (49%)
DnaJ_C 131..328 CDD:199909 60/243 (25%)
DnaJ_zf 160..>195 CDD:304418 7/44 (16%)
SPBC1347.05cNP_596697.3 DnaJ 20..389 CDD:223560 110/367 (30%)
DnaJ 24..86 CDD:278647 30/61 (49%)
DnaJ_zf 168..237 CDD:199908 12/76 (16%)
DnaJ_C 236..376 CDD:199909 45/140 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53793
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.