DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and CG30156

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:292 Identity:70/292 - (23%)
Similarity:120/292 - (41%) Gaps:64/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNP 80
            :|::....|:.|::|.:..:|..:|||:||.:||..||||||| .|.|...|:.:..|.:.|::.
  Fly    87 VVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNK-SPGAEQAFRRISEAADCLTDC 150

  Fly    81 DKRKTYD--RCGEECLKKEGMMDHGGDP--FSSFFGDFGFH--FGGD-GQQQDAP-RGADIVMDL 137
            .||..|:  ....:|        |..||  :..:.|:..|:  .|.| |.....| |||:..|..
  Fly   151 QKRIEYNIATAVGDC--------HDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMPQ 207

  Fly   138 YVSL---EELYSG-----NFVEIVRNKPVTKPASG---TRKCNCRQEMVTRNLGPGRFQMIQQTV 191
            ..||   ::|..|     .|:.:..:.....||..   ||..:.|:...|.::.    ..:..|.
  Fly   208 RQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRTNHIA----YYMNPTT 268

  Fly   192 CDECPNVKLVNEERTLEIEVEQGMVDG-----------QETRFVAEGEPHIDGEPGDLIVRVQQM 245
            ..:....:|..    ||:|:|:..:..           ::..|:...:.:.|.:   |:..|.||
  Fly   269 LSKYTEQQLAE----LEVEIEEVYISDLKHKCRQERSWRDNLFLRARQGNNDQK---LLQHVSQM 326

  Fly   246 P--------------HPRFLRKNDDLYTNVTI 263
            .              |.|.|.:|:.|..:|.:
  Fly   327 STPACQALLQLGKSGHSRLLLENESLNQDVPV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 69/286 (24%)
DnaJ 25..87 CDD:278647 24/61 (39%)
DnaJ_C 131..328 CDD:199909 31/169 (18%)
DnaJ_zf 160..>195 CDD:304418 7/37 (19%)
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 24/61 (39%)
DUF1977 237..334 CDD:286411 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.