DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajc16

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_758841.1 Gene:Dnajc16 / 214063 MGIID:2442146 Length:772 Species:Mus musculus


Alignment Length:280 Identity:75/280 - (26%)
Similarity:118/280 - (42%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLVEESFAGRDF--YKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEV 76
            |:|:.:|.:..||  |::|.|.:.|:..::||||::||:|.|||||| ||.|..:|..:..|||:
Mouse    16 LVLILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNK-DPGAEDRFIQISKAYEI 79

  Fly    77 LSNPDKRKTYDRCGE-------ECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIV 134
            |||.:||..||..|:       :..::|....|..:.|  :|.:..|||..:.:::|        
Mouse    80 LSNEEKRTNYDHYGDAGENQGYQKQQREHRFRHFHENF--YFDESFFHFPFNAERRD-------- 134

  Fly   135 MDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPGRFQMIQQTVCDECPNVK 199
                 |.:|.|..:|...|                  .|::..:........|....|..|.:::
Mouse   135 -----SGDEKYLLHFSHYV------------------NEVLPESFKRPYLIKITSDWCFSCIHIE 176

  Fly   200 LVNEERTLEIE---VEQGMVD-GQETRFV----AEGEPHIDGE---------------------- 234
            .|.:|...|:|   |..|:|. |.|.|..    |...|.|.|.                      
Mouse   177 PVWKEVVQELEGLGVGIGVVHAGYERRLAHHLGAHSTPSILGVISGKITFFHNAVVHENLRQFVE 241

  Fly   235 ---PGDLIVRVQQMPHPRFL 251
               ||:|:.:|....:.|||
Mouse   242 SLLPGNLVEKVTNKNYVRFL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 72/272 (26%)
DnaJ 25..87 CDD:278647 31/63 (49%)
DnaJ_C 131..328 CDD:199909 30/154 (19%)
DnaJ_zf 160..>195 CDD:304418 3/34 (9%)
Dnajc16NP_758841.1 DnaJ 29..>135 CDD:223560 40/121 (33%)
TRX_DnaJ 134..243 CDD:239261 24/139 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.