DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and DNAJC18

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:116 Identity:45/116 - (38%)
Similarity:62/116 - (53%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EESFAG-------RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYE 75
            ||...|       |::|:||.|.::|:..|:|||||:||.:.||||| ..|.|:..|:.:|.|:.
Human    68 EEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKN-CAPGATDAFKAIGNAFA 131

  Fly    76 VLSNPDKRKTYDRCGEECLKKEGMMDHGGDPFSSFFGD------FGFHFGG 120
            ||||||||..||..|:|.:..........:.:..|..|      |...|||
Human   132 VLSNPDKRLRYDEYGDEQVTFTAPRARPYNYYRDFEADITPEELFNVFFGG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 43/112 (38%)
DnaJ 25..87 CDD:278647 31/61 (51%)
DnaJ_C 131..328 CDD:199909
DnaJ_zf 160..>195 CDD:304418
DNAJC18NP_689899.1 DnaJ 82..143 CDD:278647 31/61 (51%)
DUF1977 250..350 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.