Sequence 1: | NP_608525.1 | Gene: | shv / 33220 | FlyBaseID: | FBgn0031256 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032325.2 | Gene: | Dnajb3 / 15504 | MGIID: | 1306822 | Length: | 242 | Species: | Mus musculus |
Alignment Length: | 267 | Identity: | 77/267 - (28%) |
---|---|---|---|
Similarity: | 112/267 - (41%) | Gaps: | 66/267 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKD-DPDASTKFQDLGAAYEVLSNPDKRKTYDR 88
Fly 89 CGEECLKKEGMMDHGG-----------------DP---FSSFFG---DFGF-HFGGD------GQ 123
Fly 124 QQDA----PRGADIVMDLYVSLEEL--YSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPG 182
Fly 183 RFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGEPGDLIVRVQQMPH 247
Fly 248 PRFLRKN 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shv | NP_608525.1 | DnaJ | 22..346 | CDD:223560 | 77/267 (29%) |
DnaJ | 25..87 | CDD:278647 | 26/62 (42%) | ||
DnaJ_C | 131..328 | CDD:199909 | 27/126 (21%) | ||
DnaJ_zf | 160..>195 | CDD:304418 | 3/34 (9%) | ||
Dnajb3 | NP_032325.2 | DnaJ | 3..66 | CDD:278647 | 26/62 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |