DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and LOC1281303

DIOPT Version :10

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_321247.5 Gene:LOC1281303 / 1281303 VectorBaseID:AGAMI1_005898 Length:362 Species:Anopheles gambiae


Alignment Length:69 Identity:30/69 - (43%)
Similarity:49/69 - (71%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDR 88
            :|:|::|.|.|:|..:::||||::||.:|||||| ..|.|...|:.:|.|..:|::.:||::||.
Mosquito   103 KDYYEVLGVAKDATDSDIKKAYKKLALQLHPDKN-HAPGAVEAFKAIGNAVAILTDAEKRRSYDL 166

  Fly    89 CGEE 92
            .|.|
Mosquito   167 YGSE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 30/68 (44%)
LOC1281303XP_321247.5 DnaJ_bact 104..>222 CDD:274090 30/68 (44%)
DUF1977 257..357 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.