DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajb5

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_012821923.1 Gene:dnajb5 / 100487123 XenbaseID:XB-GENE-995211 Length:407 Species:Xenopus tropicalis


Alignment Length:385 Identity:115/385 - (29%)
Similarity:173/385 - (44%) Gaps:106/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:||||.:...||.:|:|||||::|.:.|||||| |.:|..||:::..||:|||:|.||..||
 Frog    61 GKDYYKILGLASGANEDEIKKAYRKMALKYHPDKNK-DANAEDKFKEIAEAYDVLSDPKKRAVYD 124

  Fly    88 RCGEECLK-------KEGMMDH----------------GGDPFSSFFGDF------GFH------ 117
            :.|||.||       ..|...|                |.:||..|||..      ||.      
 Frog   125 QYGEEGLKTGGGSTGNTGSSFHYTFHGDPHATFASFFGGSNPFDIFFGSSRSRMSNGFDHEDMDI 189

  Fly   118 -------FGGDG----------------------QQQDAPRGADIVMDLYVSLEELYSGNFVEIV 153
                   |||.|                      :.||.|    :|.:|.|||||:|.|      
 Frog   190 NEDEDDLFGGFGRFGFSGVNGFHKRHQDQLHSRRKVQDPP----VVHELKVSLEEIYHG------ 244

  Fly   154 RNKPVTKPASGTRKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVD 217
                          |..|.::..|.|.| ||               .:..|::.|.:.:::|..:
 Frog   245 --------------CTKRMKITRRRLNPDGR---------------TVRTEDKILNVVIKKGWKE 280

  Fly   218 GQETRFVAEGEPHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGH 282
            |.:..|..||:...:..|.|::..::..||..|.|...::.....|:|::||.|.::.|..:||.
 Frog   281 GTKITFPKEGDATSENIPADIVFLLKDKPHALFKRDGSNIVYTAKITLKEALCGCTVNIPTIDGR 345

  Fly   283 LVPVTREKVTWPGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKIL 342
            ::|:....|..|||..|.:|||:|..:..|..|:|.:.|.|.||.: :.:..:|.||:.|
 Frog   346 VIPLPCSDVIKPGAVKRLRGEGLPFPKVPNQRGDLIVEFQVRFPDR-IPQPTRELLKQHL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 115/385 (30%)
DnaJ 25..87 CDD:278647 32/61 (52%)
DnaJ_C 131..328 CDD:199909 54/197 (27%)
DnaJ_zf 160..>195 CDD:304418 7/35 (20%)
dnajb5XP_012821923.1 DnaJ 60..402 CDD:223560 113/381 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.