DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajb4

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001096404.1 Gene:dnajb4 / 100125006 XenbaseID:XB-GENE-1007708 Length:357 Species:Xenopus tropicalis


Alignment Length:366 Identity:114/366 - (31%)
Similarity:162/366 - (44%) Gaps:114/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:|.:|.::|.|:.:::|||||:.|.:.|||||| ...|..||:::..||||||:|.||:.||
 Frog     2 GKDYYSVLGIEKGASEDDIKKAYRKQALKWHPDKNK-SAHAEEKFKEIAEAYEVLSDPKKREVYD 65

  Fly    88 RCGEECLK-KEGMMD-HG--------GDP---FSSFFG---DFGFHFG---------------GD 121
            :.|||.|| ..|..| ||        |||   |::|||   .|...||               ||
 Frog    66 QFGEEGLKGGSGAPDGHGGNFHYTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGD 130

  Fly   122 --------------------GQQ----QDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPA 162
                                |.|    ||.|    |:.||.|||||:|:|               
 Frog   131 PFSSFTSFNMNGFPREKNQVGNQFRRKQDPP----IIHDLRVSLEEIYTG--------------- 176

  Fly   163 SGTRKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAE 226
                 |..|..:..:.|.| ||               .:..|::.|.||:::|..:|.:..|..|
 Frog   177 -----CTKRMRISRKRLNPDGR---------------SVRTEDKILTIEIKKGWKEGTKITFPRE 221

  Fly   227 GEPHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKV 291
            |:......|.|::..|:..||..|.|...::...|.:||::||.|.|:.:..|||..:|:|...:
 Frog   222 GDEAPMTIPADIVFVVKDKPHTHFKRDGSNIVCPVRVSLREALCGCSINVPTLDGRSIPMTINDI 286

  Fly   292 TWPGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTE 332
            ..||.|.|..|.|:|                  ||||..|:
 Frog   287 IKPGMRRRIIGYGLP------------------FPKKPRTK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 114/366 (31%)
DnaJ 25..87 CDD:278647 29/61 (48%)
DnaJ_C 131..328 CDD:199909 53/197 (27%)
DnaJ_zf 160..>195 CDD:304418 6/35 (17%)
dnajb4NP_001096404.1 DnaJ_bact 4..307 CDD:274090 112/360 (31%)
DnaJ 4..65 CDD:278647 29/61 (48%)
DnaJ_C 160..304 CDD:199909 53/200 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.