DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crq and CD36

DIOPT Version :9

Sequence 1:NP_001245823.1 Gene:crq / 33219 FlyBaseID:FBgn0015924 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_000063.2 Gene:CD36 / 948 HGNCID:1663 Length:472 Species:Homo sapiens


Alignment Length:493 Identity:119/493 - (24%)
Similarity:234/493 - (47%) Gaps:58/493 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCKCCGETQRKVWVFGLGSVFLLLGILIVVFWPGIADNLVEDGLTLKPGTDAYESWLEAPIPIYL 66
            |.:.||.....|    :|:|..:.|.:::.....:....::..:.|:.||.|:::|::....:|.
Human     3 CDRNCGLIAGAV----IGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYR 63

  Fly    67 SFYMFNWTNPEDIRNPDIKPNFVEMGPYTFLEKH-KKENYT--FYDNATVAYYERRTWFFDPERS 128
            .|::|:..||:::..........:.||||:..:. .|||.|  ..|| ||::.:.....|:|..|
Human    64 QFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDN-TVSFLQPNGAIFEPSLS 127

  Fly   129 NGTLDDMVTAAHAITATVADEMRDQRKIVKKIINFMLNHEGGKLYVTKPVGEWIFEGYQDNITDF 193
            .||..|..|..:...|..:...::|  .|:.|:|.::|.....::..:.:.|.:: ||:|   .|
Human   128 VGTEADNFTVLNLAVAAASHIYQNQ--FVQMILNSLINKSKSSMFQVRTLRELLW-GYRD---PF 186

  Fly   194 LNLFN---TTKIDI--PYKRFGWLADRNESLTYDGLFTIHTGTDDISNLGRLTHWNGKSETGFYE 253
            |:|..   ||.:.:  ||..           |.||::.:..|.|:||.:..:..:.||....::|
Human   187 LSLVPYPVTTTVGLFYPYNN-----------TADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE 240

  Fly   254 MPCGIVNGTTGDMFPPKMNVNDEITIFATDACRF--------MNLRPRGTYENHGLTATKWVGTE 310
            ..|.::|||....|||.:..:..:..|::|.||.        :||:        |:...::|...
Human   241 SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLK--------GIPVYRFVLPS 297

  Fly   311 ETLDSGENYPNQACFCDEARFDE-CPKTGVVECKACRDKAPIYSSFPHFYLADQSYVDAVSGMKP 374
            :...|....|:..|||.|....: |...||::...|::..|:|.|.|||..|.....:.:.|:.|
Human   298 KAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNP 362

  Fly   375 EKEKHEFFLAVEPITGVPVQVHGRIQINMMIEPDDDFDIYRGVQK-VLMPMFWFDQYAELSSELA 438
            .:|:|..:|.:|||||..:|...|:|:|::::|.:...:.:.::: .::|:.|.::...:..|.|
Human   363 NEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKA 427

  Fly   439 S--KAKLAINLSSYGIIFGYSMIAFASVFLITGITLTV 474
            :  ::::...::..|:|        ..:.|..|:.:.|
Human   428 NMFRSQVTGKINLLGLI--------EMILLSVGVVMFV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crqNP_001245823.1 CD36 19..470 CDD:307331 113/470 (24%)
CD36NP_000063.2 CD36 14..463 CDD:395898 116/482 (24%)
Required for interaction with thrombospondins, THBS1 and THBS2. /evidence=ECO:0000269|PubMed:1371676 93..120 8/27 (30%)
Interaction with PTK2, PXN and LYN. /evidence=ECO:0000269|PubMed:20037584 460..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.