DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crq and Cd36

DIOPT Version :9

Sequence 1:NP_001245823.1 Gene:crq / 33219 FlyBaseID:FBgn0015924 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_113749.2 Gene:Cd36 / 29184 RGDID:2301 Length:472 Species:Rattus norvegicus


Alignment Length:501 Identity:123/501 - (24%)
Similarity:235/501 - (46%) Gaps:75/501 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCKCCGETQRKVWVFGLGSVFLLLGILIVVFWPGIADNLVEDGLTLKPGTDAYESWLEAPIPIYL 66
            |.:.||.....|    :|:|..:.|.:::.....:.:..::..:.|:.||.|:::|::....:|.
  Rat     3 CDRNCGLITGAV----IGAVLAVFGGILMPVGDLLIEKTIKREVVLEEGTIAFKNWVKTGTTVYR 63

  Fly    67 SFYMFNWTNPEDIRNPDIKPNFVEMGPYTFLEKH-KKENYTFYD--NATVAYYERRTWFFDPERS 128
            .|::|:..|||::.....|....:.||||:..:: .|||.| .|  ::||::.:.....|:|..|
  Rat    64 QFWIFDVQNPEEVAKNSSKIKVKQRGPYTYRVRYLAKENIT-QDPKDSTVSFVQPNGAIFEPSLS 127

  Fly   129 NGTLDDMVT--------AAHAITATVADEMRDQRKIVKKIINFMLNHEGGKLYVTKPVGEWIFEG 185
            .||.:|..|        |.|..|          ...|:.::|.::......::.|:.:.|.:: |
  Rat   128 VGTENDNFTVLNLAVAAAPHIYT----------NSFVQGVLNSLIKKSKSSMFQTRSLKELLW-G 181

  Fly   186 YQDNITDFLNLF-----NTTKIDIPYKRFGWLADRNESLTYDGLFTIHTGTDDISNLGRLTHWNG 245
            |:|   .||:|.     .|..:..||..           |.||::.:..|.|:||.:..:..:.|
  Rat   182 YKD---PFLSLVPYPISTTVGVFYPYNN-----------TVDGVYKVFNGKDNISKVAIIDTYKG 232

  Fly   246 KSETGFYEMPCGIVNGTTGDMFPPKMNVNDEITIFATDACRF--------MNLRPRGTYENHGLT 302
            |....::|..|.::|||....|||.:..:..:..|::|.||.        :||:        |:.
  Rat   233 KRNLSYWESYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEVNLK--------GIP 289

  Fly   303 ATKWVGTEETLDSGENYPNQACFCDEARF-DECPKTGVVECKACRDKAPIYSSFPHFYLADQSYV 366
            ..::|.......|....|:..|||.|... :.|...||::...|::..|:|.|.|||..|.....
  Rat   290 VYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVS 354

  Fly   367 DAVSGMKPEKEKHEFFLAVEPITGVPVQVHGRIQINMMIEPDDDFDIYRGVQK-VLMPMFWF--- 427
            :.:.|:.|.:::|..:|.||||||..:|...|:|:|::::|....:..:.::: .::|:.|.   
  Rat   355 EPIEGLNPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNET 419

  Fly   428 ----DQYAEL-SSELASKAKLAINLSSYGIIFGYSMIAFASVFLIT 468
                |:.||: .:::..|.|| :.|... ::.|..::.|.: |:|:
  Rat   420 GTIGDEKAEMFRNQVTGKIKL-LGLVEM-VLLGVGVVMFVA-FMIS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crqNP_001245823.1 CD36 19..470 CDD:307331 119/484 (25%)
Cd36NP_113749.2 CD36 14..463 CDD:395898 120/490 (24%)
Required for interaction with thrombospondins, THBS1 and THBS2. /evidence=ECO:0000250 93..120 7/27 (26%)
Interaction with PTK2, PXN and LYN. /evidence=ECO:0000250|UniProtKB:P16671 460..472 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X155
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.