DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS8 and CDC27

DIOPT Version :9

Sequence 1:NP_608524.1 Gene:BBS8 / 33217 FlyBaseID:FBgn0031255 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_009469.2 Gene:CDC27 / 852194 SGDID:S000000180 Length:758 Species:Saccharomyces cerevisiae


Alignment Length:457 Identity:80/457 - (17%)
Similarity:140/457 - (30%) Gaps:135/457 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GRLNSSRPGSAAVARPGTSLS----RPGSSLGSRCGTASRIRATSAAAFNVGDATSKLYQASRLN 241
            |:.::|...:||.:.|.||||    |...||.|        :.......|:.:..:.|:|:|...
Yeast   212 GKKSNSHNNNAASSFPSTSLSHFEPRSQPSLYS--------KTNKNGNNNINNNVNTLFQSSNSP 268

  Fly   242 PTIYAERETLVKALFQFLYYHEADVQKAHSLCQAVLEVERQKP-----SGSTGCTLSWWWQQQMG 301
            |:      |...:.....::..:..|:|::..:.......|.|     :..|...|.       .
Yeast   269 PS------TSASSFSSIQHFSRSQQQQANTSIRTCQNKNTQTPKNPAINSKTSSALP-------N 320

  Fly   302 RCLLALHYPRRAEPFLQQ----------------------------------------------- 319
            ...:.|..|...:|.:..                                               
Yeast   321 NISMNLVSPSSKQPTISSLAKVYNRNKLLTTPPSKLLNNDRNHQNNNNNNNNNNNNNNNNNNNNN 385

  Fly   320 -----SLTSFPHP-DTYLLLSRVYQRIKQPERALLVIGEVVDSRPFDVTYRLEQARIHQAM---- 374
                 :.|:|..| :.|....|:....|.| |:|::...::.|   |.:..|.:...:.|:    
Yeast   386 NNNIINKTTFKTPRNLYSSTGRLTTSKKNP-RSLIISNSILTS---DYSITLPEIMYNFALILRS 446

  Fly   375 EQQEDALQLYRLAAKLHPINVES-----LASIAVGYFYDNNPEMALMYYRRILSLG--------- 425
            ..|.::.:..||.....|.:::.     |..:...:|...|.:|:|.|:.|:..|.         
Yeast   447 SSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDLQPARVKDMEI 511

  Fly   426 -------------------------AQSPELYCNIALCCLYGGQIDLVLPCFQRALATATQPGQK 465
                                     ...||.:|.|..........|..:..|::    |||....
Yeast   512 FSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEK----ATQLDPN 572

  Fly   466 SDIWYNLSFVAVTSGD-FNLAKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYLNAAKDV 529
            ....|.|.....:|.| .:.||.|.:..|..|.|:..|...|...|.:.|....|..|...|:.:
Yeast   573 FAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

  Fly   530 MP 531
            .|
Yeast   638 NP 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS8NP_608524.1 TPR repeat 299..322 CDD:276809 3/74 (4%)
TPR repeat 327..355 CDD:276809 7/28 (25%)
TPR_16 331..392 CDD:290168 12/64 (19%)
TPR repeat 365..389 CDD:276809 5/27 (19%)
Coatomer_WDAD <378..519 CDD:281977 34/180 (19%)
TPR_11 394..457 CDD:290150 14/101 (14%)
TPR repeat 394..424 CDD:276809 7/34 (21%)
TPR repeat 429..457 CDD:276809 6/27 (22%)
TPR_11 465..526 CDD:290150 16/61 (26%)
TPR repeat 466..493 CDD:276809 7/27 (26%)
TPR repeat 500..526 CDD:276809 6/25 (24%)
CDC27NP_009469.2 ANAPC3 39..126 CDD:403946
TPR repeat 434..466 CDD:276809 5/31 (16%)
TPR repeat 472..500 CDD:276809 7/27 (26%)
PEP_TPR_lipo <500..>741 CDD:274350 28/144 (19%)
TPR repeat 540..568 CDD:276809 7/31 (23%)
TPR repeat 573..603 CDD:276809 8/29 (28%)
TPR repeat 608..634 CDD:276809 6/25 (24%)
TPR repeat 642..668 CDD:276809
TPR repeat 676..704 CDD:276809
TPR repeat 710..737 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3477
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.