Sequence 1: | NP_608524.1 | Gene: | BBS8 / 33217 | FlyBaseID: | FBgn0031255 | Length: | 549 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477246.2 | Gene: | Tmtc3 / 37401 | FlyBaseID: | FBgn0020312 | Length: | 926 | Species: | Drosophila melanogaster |
Alignment Length: | 258 | Identity: | 53/258 - (20%) |
---|---|---|---|
Similarity: | 98/258 - (37%) | Gaps: | 56/258 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 328 DTYLLLSRVYQRIKQPERALLVIGEVVDSRPFDVTYRLEQARIHQAMEQQEDALQLYRLAAKLHP 392
Fly 393 INVESLASIAVGYFYDNNPEMALMYYR----RILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQ 453
Fly 454 RALATATQPGQKSDI---WYNLSFV---------------------------AVTSGDFNL---- 484
Fly 485 ----AKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYLNAAKDVMPDAAEVTTNLQFM 543 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BBS8 | NP_608524.1 | TPR repeat | 299..322 | CDD:276809 | |
TPR repeat | 327..355 | CDD:276809 | 8/26 (31%) | ||
TPR_16 | 331..392 | CDD:290168 | 17/60 (28%) | ||
TPR repeat | 365..389 | CDD:276809 | 6/23 (26%) | ||
Coatomer_WDAD | <378..519 | CDD:281977 | 32/182 (18%) | ||
TPR_11 | 394..457 | CDD:290150 | 13/66 (20%) | ||
TPR repeat | 394..424 | CDD:276809 | 6/33 (18%) | ||
TPR repeat | 429..457 | CDD:276809 | 6/27 (22%) | ||
TPR_11 | 465..526 | CDD:290150 | 17/98 (17%) | ||
TPR repeat | 466..493 | CDD:276809 | 7/64 (11%) | ||
TPR repeat | 500..526 | CDD:276809 | 6/25 (24%) | ||
Tmtc3 | NP_477246.2 | DUF1736 | 323..396 | CDD:369859 | |
PEP_TPR_lipo | <513..871 | CDD:274350 | 50/245 (20%) | ||
TPR repeat | 514..542 | CDD:276809 | |||
TPR repeat | 547..591 | CDD:276809 | |||
TPR repeat | 598..625 | CDD:276809 | |||
TPR repeat | 630..660 | CDD:276809 | 8/25 (32%) | ||
TPR repeat | 665..693 | CDD:276809 | 8/29 (28%) | ||
TPR repeat | 737..764 | CDD:276809 | 6/26 (23%) | ||
TPR repeat | 803..834 | CDD:276809 | 5/30 (17%) | ||
TPR repeat | 839..867 | CDD:276809 | 7/27 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45467054 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |