DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and Arl16

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_003751033.1 Gene:Arl16 / 688311 RGDID:1590059 Length:173 Species:Rattus norvegicus


Alignment Length:193 Identity:54/193 - (27%)
Similarity:86/193 - (44%) Gaps:33/193 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIP 68
            |:.||....|||.|:|.||...|           |.|           .||..:|||:.     |
  Rat     2 CLLLGAAGVGKTLLVKRLQKLSS-----------GDG-----------KGDLGEPPPTR-----P 39

  Fly    69 HGGKNLP-----KSIQILEIGGSMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPR 128
            ..|.||.     :.|.|.|:||.|:|:|..|:.:...|::::|.||..|:||:.:....:|:...
  Rat    40 TVGTNLTDIVAHRKITIRELGGCMSPIWSSYYGNCHSLLFMMDASNPTQLSASCMQLLGLLSAEE 104

  Fly   129 LQHNTKILLVLAKMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWLQ 191
            |. ...:|::..|:|........|...::::..:....:|.:|.||.||....||..:..||:
  Rat   105 LA-KASVLILFNKIDLPSYMTVEEIKSLMRLPDIIACAKQNITTVEISARNGTGLATVLLWLR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 53/191 (28%)
Arl16XP_003751033.1 Arf_Arl 1..168 CDD:206644 54/193 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0072
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49572
OrthoDB 1 1.010 - - D1383112at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107712
Panther 1 1.100 - - LDO PTHR46688
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5742
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.