DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and CG17819

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:57/115 - (49%) Gaps:6/115 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IQILEIGGSM--APLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQHNTKILLVLA 140
            :|:.:|.|.:  ..:|.:|::.|..||:|:|:::..::|.|..:...:|....|. |..:|:|..
  Fly    67 VQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELD-NAPLLIVSN 130

  Fly   141 KMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWL 190
            |.|.|.....:..:.::.:.:|   ..:..|..|.|..|..|:..|.:|:
  Fly   131 KKDASGSLSMSTVIDLMGLYRL---TGRDWTFEECSMRTGSGVQEIVNWI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 28/115 (24%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 28/115 (24%)
Ras 23..183 CDD:278499 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.