DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and ARL1

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001168.1 Gene:ARL1 / 400 HGNCID:692 Length:181 Species:Homo sapiens


Alignment Length:189 Identity:52/189 - (27%)
Similarity:81/189 - (42%) Gaps:39/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIPH 69
            :.||...||||.:|..||    :.|...::||||..:..:.:                       
Human    21 LILGLDGAGKTTILYRLQ----VGEVVTTIPTIGFNVETVTY----------------------- 58

  Fly    70 GGKNLPKSIQILEIGG--SMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQHN 132
              |||  ..|:.::||  |:.|.||.|:.:...:|||||:.:..:|..:.....::|.|..|:  
Human    59 --KNL--KFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELR-- 117

  Fly   133 TKILLVLA-KMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWL 190
            ..||:|.| |.|.......:|....|.:..|:.:..|   |.:.||....|||...:||
Human   118 KAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQ---IFKTSATKGTGLDEAMEWL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 52/189 (28%)
ARL1NP_001168.1 Arl1 19..176 CDD:206718 52/189 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.