DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and Arl5

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster


Alignment Length:193 Identity:38/193 - (19%)
Similarity:70/193 - (36%) Gaps:47/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGI-----YRIHFPTKSPNGDKNKPPPSEAP 64
            :.:|...||||.:|...    .::|...:.||||:.:     ..|||                  
  Fly    20 VMVGLDNAGKTTILYQF----LMNEVVHTSPTIGSNVEEVVWRNIHF------------------ 62

  Fly    65 ANIPHGGKNLPKSIQILEIGG--SMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEP 127
                          .:.::||  |:...|..|:.:.:.:|.|:|:::..:::......|.:|...
  Fly    63 --------------LVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHE 113

  Fly   128 RLQHNTKILLVLAKMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWL 190
            .|. ...:|:...|.|........|....|.:..::|   .|..|....|:|..||....:|:
  Fly   114 DLS-KASLLVYANKQDLKGSMSAAEISRQLDLTSIKK---HQWHIQACCALTGEGLYQGLEWI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 38/193 (20%)
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 38/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.