DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and Arfrp1

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster


Alignment Length:199 Identity:38/199 - (19%)
Similarity:80/199 - (40%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIPH 69
            :.||...||||..|:|.       :|||:....|..                   ||:....:  
  Fly    21 VILGLDNAGKTTYLEAA-------KTTFTRNYKGLN-------------------PSKITTTV-- 57

  Fly    70 GGKNLPK------SIQILEIGG--SMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTE 126
             |.|:..      .:...::||  .:..||.:|:::...:|||:|:::..::..:..:|..:: :
  Fly    58 -GLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMI-K 120

  Fly   127 PRLQHNTKILLVLAKMDYSYRQMRNEALLMLQMQKLQKQI-----RQQVTIVEASAVTKVGLDPI 186
            ..|.....:|::..|.|..      :.:.:.:::.:.:|.     |:....:..||:...|:|..
  Fly   121 NELLSGVPLLILANKQDLP------DVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEG 179

  Fly   187 YDWL 190
            ..||
  Fly   180 IKWL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 38/199 (19%)
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 36/195 (18%)
Arfrp1 19..186 CDD:206725 38/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.