DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and ARL10

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_011532831.1 Gene:ARL10 / 285598 HGNCID:22042 Length:281 Species:Homo sapiens


Alignment Length:176 Identity:39/176 - (22%)
Similarity:72/176 - (40%) Gaps:57/176 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIPH 69
            :.||...|||:..|:.|.....::.   .:||.|....|:  |||.                   
Human    81 LVLGLDGAGKSTFLRVLSGKPPLEG---HIPTWGFNSVRL--PTKD------------------- 121

  Fly    70 GGKNLPKSIQILEIGGS--MAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSIL-TEPRLQH 131
                  ..:.:||||||  :...|:::..:|..|::|||:::..::..|....:.:| .:|.|. 
Human   122 ------FEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLP- 179

  Fly   132 NTKILLVLA---------------KMDYSYRQ----MRNEALLMLQ 158
                ::|:|               :.|:|.|:    .|.:|:|:.|
Human   180 ----VVVVANKQTGSHSAAQAGVQRRDHSTRRPTYTSRAQAMLLPQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 39/176 (22%)
ARL10XP_011532831.1 P-loop_NTPase 79..>187 CDD:304359 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.