DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13692 and arl16

DIOPT Version :9

Sequence 1:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001082969.2 Gene:arl16 / 100037345 ZFINID:ZDB-GENE-070410-114 Length:177 Species:Danio rerio


Alignment Length:193 Identity:59/193 - (30%)
Similarity:88/193 - (45%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CICLGPKRAGKTHLLKALQ-----DP-ESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSE 62
            |:.||....|||.|||.||     || ..:.|...::||:||.:..:....|.            
Zfish     2 CLLLGATGVGKTLLLKRLQKLCQMDPCADLGEAPVTLPTVGTNLTDLILKKKK------------ 54

  Fly    63 APANIPHGGKNLPKSIQILEIGGSMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEP 127
                         |.|.:.|:||.|.|:|.:|:.|.|.:|:|||..|:.|||::.|...|:|:..
Zfish    55 -------------KKITVRELGGCMGPIWPKYYLDCKSVIFVVDCVNVEQISSSCVQLLSVLSAE 106

  Fly   128 RLQHNTKILLVLAKMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWL 190
            .|. :..:|::..|.|........|...:.:|..:.|...|.|||:|.||.:..||..:..||
Zfish   107 SLL-SAAVLILFNKRDLLCSMSLVELKSLFRMDDIIKSAPQFVTILEVSARSGQGLQDVLHWL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 59/193 (31%)
arl16NP_001082969.2 P-loop_NTPase 1..171 CDD:304359 59/193 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49572
OrthoDB 1 1.010 - - D1383112at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107712
Panther 1 1.100 - - LDO PTHR46688
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5742
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.