DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11885 and PSMG3

DIOPT Version :9

Sequence 1:NP_608522.1 Gene:CG11885 / 33215 FlyBaseID:FBgn0031253 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001127812.1 Gene:PSMG3 / 84262 HGNCID:22420 Length:122 Species:Homo sapiens


Alignment Length:127 Identity:32/127 - (25%)
Similarity:52/127 - (40%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RQFSADVNGVPTEIVFHCFAKKWFLVITQLGKIPGIY-----NVHFDVKKDERVVPYLHGPVDNP 74
            :|.:..|.||||::|...|:....:|:||.||:..:.     :|..||.|.......|.|. |.|
Human    10 KQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ-DEP 73

  Fly    75 EFHVSVPITMNCCLGLDTDETRSAIQFLVNRTGLHKCPTEFVVGLGLKKIDGPNLRALAKVL 136
            ..||.               .::.:.|:....|  .......|.:..|.::|  |:||.:|:
Human    74 LIHVF---------------AKNLVAFVSQEAG--NRAVLLAVAVKDKSMEG--LKALREVI 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11885NP_608522.1 PAC3 39..137 CDD:287187 24/103 (23%)
PSMG3NP_001127812.1 PAC3 34..119 CDD:401986 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469039at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31051
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.