powered by:
Protein Alignment CG11885 and SPBC16E9.19
DIOPT Version :9
Sequence 1: | NP_608522.1 |
Gene: | CG11885 / 33215 |
FlyBaseID: | FBgn0031253 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001342981.1 |
Gene: | SPBC16E9.19 / 2539779 |
PomBaseID: | SPBC16E9.19 |
Length: | 143 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 42 |
Identity: | 10/42 - (23%) |
Similarity: | 23/42 - (54%) |
Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 RQFSADVNGVPTEIVFHCFAKKWFLVITQLGKIPGIYNVHFD 56
:|.|.:.||...:.:...|:.:..:::|..|||..:|.:.::
pombe 6 KQTSKNYNGKEIQAISMRFSNQITILVTISGKIGQMYMMTYE 47
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11885 | NP_608522.1 |
PAC3 |
39..137 |
CDD:287187 |
5/18 (28%) |
SPBC16E9.19 | NP_001342981.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR31051 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.