DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11885 and Psmg3

DIOPT Version :9

Sequence 1:NP_608522.1 Gene:CG11885 / 33215 FlyBaseID:FBgn0031253 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_002727987.1 Gene:Psmg3 / 100361517 RGDID:2319950 Length:122 Species:Rattus norvegicus


Alignment Length:136 Identity:32/136 - (23%)
Similarity:57/136 - (41%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKPRQIGFDRQFSADVNGVPTEIVFHCFAKKWFLVITQLGKIPGIY-----NVHFDVKKDERVVP 65
            :||..:  .:|.:..|.||||::|...|:....:|:||.||:..:.     ||..|:.|......
  Rat     3 DKPLVV--SKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSNVANDISKPVLTTK 65

  Fly    66 YLHGPVDNPEFHVSVPITMNCCLGLDTDETRSAIQFLVNRTGLHKCPTEFVVGLGLKKIDGPNLR 130
            .|.|. |.|..||.               .::.:.|:....|    ....::.:.:|:.:...|:
  Rat    66 VLLGQ-DEPLIHVF---------------AKNLVAFVSEEAG----DRAVLLAMAVKEKNMERLK 110

  Fly   131 ALAKVL 136
            ||.:|:
  Rat   111 ALKEVI 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11885NP_608522.1 PAC3 39..137 CDD:287187 22/103 (21%)
Psmg3XP_002727987.1 PAC3 34..119 CDD:401986 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469039at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31051
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.