DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11885 and psmg3

DIOPT Version :9

Sequence 1:NP_608522.1 Gene:CG11885 / 33215 FlyBaseID:FBgn0031253 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001120261.1 Gene:psmg3 / 100145313 XenbaseID:XB-GENE-996246 Length:125 Species:Xenopus tropicalis


Alignment Length:127 Identity:33/127 - (25%)
Similarity:50/127 - (39%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TANKPRQIGFDRQFSADVNGVPTEIVFHCFAKKWFLVITQLGKIPGIYN-----VHFDVKKDERV 63
            |..||..:  .:|....:|||.|::|...|..:..:|:||.||:..:.:     |..|:.|....
 Frog     4 TDAKPAVV--SKQAEVVINGVATQVVCSAFTNQILVVVTQYGKMGTLVSVTPSLVSSDLGKPSLT 66

  Fly    64 VPYLHGPVDNPEFHVSVPITMNCCLGLDTDETRSAIQFLVNRTGLHKCPTEFVVGLGLKKID 125
            ...|.|. |.|..||       |...|.|         .|::...:| |....:.|..|.:|
 Frog    67 TKVLLGQ-DEPLVHV-------CAKNLVT---------FVSQEAKNK-PVLLSIALKDKSVD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11885NP_608522.1 PAC3 39..137 CDD:287187 23/92 (25%)
psmg3NP_001120261.1 PAC3 37..120 CDD:287187 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469039at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31051
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.