powered by:
Protein Alignment RpLP1 and CCT2
DIOPT Version :9
Sequence 1: | NP_001259822.1 |
Gene: | RpLP1 / 33214 |
FlyBaseID: | FBgn0002593 |
Length: | 112 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012124.1 |
Gene: | CCT2 / 854664 |
SGDID: | S000001404 |
Length: | 527 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
Similarity: | 22/63 - (34%) |
Gaps: | 2/63 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 KALEGINVKDLITNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLF 111
|.:| |.|.||.|...........|......:.|..|:.:|.|::|.:.........|...|
Yeast 224 KRIE--NAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTF 284
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.820802 |
Normalized mean entropy |
S11 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.