DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and CCT2

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_012124.1 Gene:CCT2 / 854664 SGDID:S000001404 Length:527 Species:Saccharomyces cerevisiae


Alignment Length:63 Identity:15/63 - (23%)
Similarity:22/63 - (34%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KALEGINVKDLITNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLF 111
            |.:|  |.|.||.|...........|......:.|..|:.:|.|::|.:.........|...|
Yeast   224 KRIE--NAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 14/61 (23%)
CCT2NP_012124.1 TCP1_beta 5..520 CDD:239452 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.820802 Normalized mean entropy S11
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.