DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and RPP2B

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_010670.3 Gene:RPP2B / 851990 SGDID:S000002790 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:39/105 - (37%)
Similarity:58/105 - (55%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ASLILVD-DDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGI-NVKDLITNIGSGVGAAPAGG 74
            |.|:||. .:.|.:...|..::::...||:.........:|||. :::::|..........|.||
Yeast     6 AYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKGSLEEIIAEGQKKFATVPTGG 70

  Fly    75 AAPAAAAAAPAAE--SKKEEKKKEEESDQSDDDMGFGLFD 112
            |:.|||.||.||.  ...||:|:||..::|||||||||||
Yeast    71 ASSAAAGAAGAAAGGDAAEEEKEEEAKEESDDDMGFGLFD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 36/102 (35%)
RPP2BNP_010670.3 Ribosomal_P2 1..110 CDD:100111 37/103 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.