DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and AT1G01100

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001077439.1 Gene:AT1G01100 / 839410 AraportID:AT1G01100 Length:112 Species:Arabidopsis thaliana


Alignment Length:116 Identity:68/116 - (58%)
Similarity:83/116 - (71%) Gaps:8/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65
            |||..||||.||.:||.|:.:|:|.:||.|::|||.|.:|.|||.||||..|..||.|||.|:|:
plant     1 MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPMLFAKMAEKRNVTDLIMNVGA 65

  Fly    66 -GVGAAPAGGAAPAA---AAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
             |.|.||...|||||   |||||||    |||||:|.:::||.|:||||||
plant    66 GGGGGAPVAAAAPAAGGGAAAAPAA----EEKKKDEPAEESDGDLGFGLFD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 62/108 (57%)
AT1G01100NP_001077439.1 Ribosomal_P1 6..111 CDD:100109 62/108 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2378
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I1936
OMA 1 1.010 - - QHG53507
OrthoDB 1 1.010 - - D1633925at2759
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - otm2980
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45696
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.