DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and AT5G24510

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_197839.1 Gene:AT5G24510 / 832522 AraportID:AT5G24510 Length:111 Species:Arabidopsis thaliana


Alignment Length:116 Identity:59/116 - (50%)
Similarity:74/116 - (63%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65
            ||| :||||.||:|||.||.:.:|.|.|:.::|.|||.||.|||.||||..|..|:.|||.|:|:
plant     1 MST-SELACTYAALILHDDGIEITAENISKLVKTANVNVESYWPSLFAKLCEKKNIDDLIMNVGA 64

  Fly    66 GVGAAPAGGAAPAAAAAAPAAESKK--EEKKKEEE--SDQSDDDMGFGLFD 112
            |    ..|.|.|...||..|::|..  ||||.|.|  .::|:|||..||||
plant    65 G----GCGVARPVTTAAPTASQSVSIPEEKKNEMEVIKEESEDDMIIGLFD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 53/108 (49%)
AT5G24510NP_197839.1 Ribosomal_P1 5..110 CDD:100109 53/108 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53507
OrthoDB 1 1.010 - - D1633925at2759
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - otm2980
orthoMCL 1 0.900 - - OOG6_101037
Panther 1 1.100 - - O PTHR45696
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.