DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and Rplp1

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_061341.1 Gene:Rplp1 / 56040 MGIID:1927099 Length:114 Species:Mus musculus


Alignment Length:117 Identity:72/117 - (61%)
Similarity:91/117 - (77%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65
            |::.:||||:|::|||.||:|.||.:|||.::|||.|.|||:|||||||||..:|:..||.|:|:
Mouse     1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVSVEPFWPGLFAKALANVNIGSLICNVGA 65

  Fly    66 G-----VGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
            |     .|||||||||| :.|||||.|.|.|.||  |||::|:|||||||||
Mouse    66 GGPAPAAGAAPAGGAAP-STAAAPAEEKKVEAKK--EESEESEDDMGFGLFD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 68/109 (62%)
Rplp1NP_061341.1 Ribosomal_P1 6..>63 CDD:100109 35/56 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..114 31/47 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6191
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4487
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53507
OrthoDB 1 1.010 - - D1633925at2759
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - otm42870
orthoMCL 1 0.900 - - OOG6_101037
Panther 1 1.100 - - LDO PTHR45696
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1148
SonicParanoid 1 1.000 - - X1263
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.