DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and rplp1

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001017204.1 Gene:rplp1 / 549958 XenbaseID:XB-GENE-5769637 Length:113 Species:Xenopus tropicalis


Alignment Length:115 Identity:70/115 - (60%)
Similarity:94/115 - (81%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65
            |::.:||||:|::|||.||:|::|.:||:|::|.|.|.:||:||.||||||..||:..||:|:|:
 Frog     1 MASVSELACIYSALILHDDEVSITEDKISTLIKTAGVTIEPFWPSLFAKALANINIGSLISNVGA 65

  Fly    66 GVGAAPAGGAAPAAAA---AAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
            |.||..||||||:||:   ||||.|.|:||||  |||::|||||||||||
 Frog    66 GGGAPAAGGAAPSAASAGGAAPAEEKKEEEKK--EESEESDDDMGFGLFD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 66/107 (62%)
rplp1NP_001017204.1 Ribosomal_P1 6..>63 CDD:100109 32/56 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6058
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4368
OMA 1 1.010 - - QHG53507
OrthoDB 1 1.010 - - D1633925at2759
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - oto102997
Panther 1 1.100 - - LDO PTHR45696
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1148
SonicParanoid 1 1.000 - - X1263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.