DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and RGD1564744

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_234961.1 Gene:RGD1564744 / 314652 RGDID:1564744 Length:113 Species:Rattus norvegicus


Alignment Length:117 Identity:65/117 - (55%)
Similarity:83/117 - (70%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65
            |::.:||.|:|:.||| .|:|.||.:|||.::|||.|.||.:|||||||||..:|:..||.|:|:
  Rat     1 MASVSELTCIYSDLIL-HDEVMVTEDKINALIKAAGVNVELFWPGLFAKALANVNIGSLICNVGA 64

  Fly    66 G-----VGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
            |     .|||||||.|| :..||||.|.|.|.||  |||::|:||..|||||
  Rat    65 GGPAPAAGAAPAGGPAP-STVAAPAEEKKVEAKK--EESEESEDDTSFGLFD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 61/109 (56%)
RGD1564744XP_234961.1 Ribosomal_P1 6..>62 CDD:100109 32/56 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6112
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4424
OMA 1 1.010 - - QHG53507
OrthoDB 1 1.010 - - D1633925at2759
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - otm44933
orthoMCL 1 0.900 - - OOG6_101037
Panther 1 1.100 - - O PTHR45696
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.