DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and rpp103

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_588562.1 Gene:rpp103 / 2539598 PomBaseID:SPCP1E11.09c Length:109 Species:Schizosaccharomyces pombe


Alignment Length:109 Identity:61/109 - (55%)
Similarity:78/109 - (71%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS-GVG 68
            :|||..||:|||.|:.:.:|.:|:.::.||.||||||.|..:|||||||.::|:|:.|||| |..
pombe     4 SELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLKELLLNIGSAGAA 68

  Fly    69 AAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
            :||....|.|||.|..|.|.||||.|:|||   ||:||||||||
pombe    69 SAPTAAGAGAAAPAEAAEEEKKEEAKEEEE---SDEDMGFGLFD 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 58/105 (55%)
rpp103NP_588562.1 Ribosomal_P1 5..108 CDD:100109 58/105 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I1754
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I1496
OMA 1 1.010 - - QHG53507
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - otm47118
orthoMCL 1 0.900 - - OOG6_101037
Panther 1 1.100 - - O PTHR45696
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1148
SonicParanoid 1 1.000 - - X1263
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.