DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and rla-2

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001370088.1 Gene:rla-2 / 178297 WormBaseID:WBGene00004410 Length:110 Species:Caenorhabditis elegans


Alignment Length:114 Identity:49/114 - (42%)
Similarity:61/114 - (53%) Gaps:18/114 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YASLILVDDDVAVTG-------EKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGSGV- 67
            |.|..|    :||.|       :.:..||.|..|:.:.....|....|.|..|::||....:|: 
 Worm     3 YVSAYL----LAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGKTVEELIAEGSAGLV 63

  Fly    68 ----GAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
                |||||..|||||..|||||:||  ..||||..::|||||||||||
 Worm    64 SVSGGAAPAAAAAPAAGGAAPAADSK--PAKKEEPKEESDDDMGFGLFD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 46/111 (41%)
rla-2NP_001370088.1 Ribosomal_P2 1..110 CDD:100111 47/112 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.