DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and mrt-2

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_499521.1 Gene:mrt-2 / 176608 WormBaseID:WBGene00003417 Length:267 Species:Caenorhabditis elegans


Alignment Length:122 Identity:26/122 - (21%)
Similarity:41/122 - (33%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ELACVYASLILVDD---DVAVTGEKINT---ILKAANVEVEPYWPGLFAKALEGINVK------- 57
            |||.|:.::...|.   ..:..|.||..   ..:.|:|.:.|.:...|....|.:::|       
 Worm    21 ELAQVFKTVAFKDTGTWHASEAGMKITVDDGSYQLASVFINPAFFSSFKVREEIVSMKISIKSIS 85

  Fly    58 ---DLITNIGSGVGAAPAGGAAPAAAAAAPA----AESKKEEKKKEEESDQSDDDMG 107
               .:..|..|.|..:..|...|.......|    |.........::|.|...||.|
 Worm    86 EFLSISENSSSSVKVSYPGMFQPVKMLVEDADGWVARGNFTTTLADQELDFEFDDAG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 26/122 (21%)
mrt-2NP_499521.1 Rad1 11..246 CDD:307997 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.820802 Normalized mean entropy S11
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.