DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and rla-1

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001380045.1 Gene:rla-1 / 171766 WormBaseID:WBGene00004409 Length:111 Species:Caenorhabditis elegans


Alignment Length:115 Identity:80/115 - (69%)
Similarity:95/115 - (82%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGS 65
            |::..|||||||:|||.||:||:|||||.|:|||||||.||||||||||||||::||:|||::.|
 Worm     1 MASNQELACVYAALILQDDEVAITGEKIATLLKAANVEFEPYWPGLFAKALEGVDVKNLITSVSS 65

  Fly    66 GVGAAP---AGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
            |.|:.|   |..|||||..||||||:||:|:.|||    |||||||||||
 Worm    66 GAGSGPAPAAAAAAPAAGGAAPAAETKKKEEPKEE----SDDDMGFGLFD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 76/107 (71%)
rla-1NP_001380045.1 Ribosomal_P1 6..110 CDD:100109 76/107 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166828
Domainoid 1 1.000 125 1.000 Domainoid score I3399
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137661
Inparanoid 1 1.050 157 1.000 Inparanoid score I2912
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53507
OrthoDB 1 1.010 - - D1633925at2759
OrthoFinder 1 1.000 - - FOG0001374
OrthoInspector 1 1.000 - - oto18618
orthoMCL 1 0.900 - - OOG6_101037
Panther 1 1.100 - - LDO PTHR45696
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1148
SonicParanoid 1 1.000 - - X1263
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.