DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP1 and Rplp2

DIOPT Version :9

Sequence 1:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001025192.1 Gene:Rplp2 / 140662 RGDID:621775 Length:115 Species:Rattus norvegicus


Alignment Length:102 Identity:44/102 - (43%)
Similarity:57/102 - (55%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGSGVG---AAPAGG----------A 75
            :.:.|..||.:..:|.:..........|.|.|::|:   |..|||   :.||||          |
  Rat    19 SAKDIKKILDSVGIEADDERLNKVISELNGKNIEDV---IAQGVGKLASVPAGGAVAVSAAPGSA 80

  Fly    76 APAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112
            ||||.:|..|||.||:|||  |||::|||||||||||
  Rat    81 APAAGSAPAAAEEKKDEKK--EESEESDDDMGFGLFD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 41/99 (41%)
Rplp2NP_001025192.1 Ribosomal_P2 1..>66 CDD:100111 12/49 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..115 26/40 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.