DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13690 and AT2G25100

DIOPT Version :9

Sequence 1:NP_608521.1 Gene:CG13690 / 33213 FlyBaseID:FBgn0031252 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_565584.1 Gene:AT2G25100 / 817048 AraportID:AT2G25100 Length:296 Species:Arabidopsis thaliana


Alignment Length:291 Identity:136/291 - (46%)
Similarity:184/291 - (63%) Gaps:19/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KPCMLGVDEAGRGPVLGPMVYGISYCPLESNKALEDLGCADSKQLTEGKRDIIFNDINTKEYATS 133
            :||::|:|||||||||||||||..|||:....:|..|..||||.|.|.||:.::..:...:    
plant    13 QPCLMGIDEAGRGPVLGPMVYGCMYCPISYQSSLASLHFADSKTLKEEKREELYESLKLDK---- 73

  Fly   134 CVGWAVEIISPNTISTSMYRRSKCSLNEVSMDSAMGLIQQAIDAGVNIAEVYVDTVGPPEKYQEK 198
            .:||||::|.|..:|..|..::|.:|||:|.:||||||::.:|.||.:.|.|:||||.|:||:.|
plant    74 SLGWAVDVIDPRELSAKMLAKNKTNLNEISHNSAMGLIKRVLDMGVLLTEAYLDTVGDPDKYRIK 138

  Fly   199 LLKRFPSFKITVAKKADSTYPIVSAASICAKVTRDHALKVWSFPE-GLVIKDNEFGSGYPGDPVT 262
            |.:||||.|..|:|||||.:||||.|||.||||||.|||.|...| |..|..| |||||||||.|
plant   139 LSERFPSIKFVVSKKADSLFPIVSGASIVAKVTRDRALKEWLVEETGEDINRN-FGSGYPGDPET 202

  Fly   263 RRFLTEYIDLVFGFPRLVRFSWSTAENAL---ADKAYDMEFDEPD---SEKPKYAGTKLTKF-FK 320
            :.:|.::...|||||.||||||.|....|   .:.|::.:.:|..   |...:.|  ||:.| ||
plant   203 KAWLVQHKHSVFGFPSLVRFSWGTCTTHLKGEVEVAWEADENEESGNGSSSKRQA--KLSSFGFK 265

  Fly   321 GTTKSGEII----REECRFFKQRHLESVMEF 347
            ...|..|.|    :..|:|.:.|.::.:.:|
plant   266 TCEKRSEEIESSGKGRCKFLQARKIQQLTQF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13690NP_608521.1 RNase_HII_eukaryota_like 73..295 CDD:260002 118/225 (52%)
AT2G25100NP_565584.1 RNase_HII_eukaryota_like 17..234 CDD:260002 118/221 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 228 1.000 Domainoid score I668
eggNOG 1 0.900 - - E1_COG0164
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4664
Inparanoid 1 1.050 244 1.000 Inparanoid score I1061
OMA 1 1.010 - - QHG62152
OrthoDB 1 1.010 - - D1354466at2759
OrthoFinder 1 1.000 - - FOG0003820
OrthoInspector 1 1.000 - - oto3203
orthoMCL 1 0.900 - - OOG6_100555
Panther 1 1.100 - - LDO PTHR10954
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.