DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2alpha and gba2

DIOPT Version :9

Sequence 1:NP_995607.1 Gene:AP-2alpha / 33211 FlyBaseID:FBgn0264855 Length:952 Species:Drosophila melanogaster
Sequence 2:XP_005172389.1 Gene:gba2 / 559240 ZFINID:ZDB-GENE-070522-3 Length:851 Species:Danio rerio


Alignment Length:130 Identity:31/130 - (23%)
Similarity:50/130 - (38%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERAEGCEVVSPIDQSRGGKESEASADESLLFYCKSKEAEVKRINKELAN------------IRS 53
            |.|...||  |...:.|...|..::|.:.||:  ..|........:.|:|            :|:
Zfish   650 MARVLNCE--SVYQRYRDILERGSAAFDKLLW--NGKYYNYDSSGRSLSNSVMSDQCAGHWFLRA 710

  Fly    54 KFKGDKTLDGYQKKKYVCKLLFIFLLGHDIDF--GHMEAVNLL--------SSNKYSEKQIGYLF 108
            ...||.....:.|:|....|..:|.| :.:.|  |.|.|||.:        ||.:..|..:|.::
Zfish   711 SGLGDDEYQAFPKEKICSALKSVFDL-NVMSFAGGQMGAVNGMRPEGVPDRSSVQSDEVWVGVVY 774

  Fly   109  108
            Zfish   775  774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2alphaNP_995607.1 Adaptin_N 40..598 CDD:279882 20/91 (22%)
Alpha_adaptinC2 730..839 CDD:197886
Alpha_adaptin_C 839..947 CDD:280460
gba2XP_005172389.1 GBA2_N 105..399 CDD:289023
DUF608 469..836 CDD:282531 31/130 (24%)
GDE_C <567..>694 CDD:283786 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.