DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and PHO2

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_010177.1 Gene:PHO2 / 851452 SGDID:S000002264 Length:559 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:25/77 - (32%)
Similarity:43/77 - (55%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVW 132
            :|.::...|.:..|   ||..||......|:.|::.|.....|.:..|::::..||:.|..:::|
Yeast    63 NDMSASSNASDSGP---QRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIW 124

  Fly   133 FQNRRAKWRKQE 144
            |||||||.||::
Yeast   125 FQNRRAKLRKKQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 19/55 (35%)
OAR 374..391 CDD:461067
PHO2NP_010177.1 COG5576 53..183 CDD:227863 25/77 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.