DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and RAX2

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001306003.2 Gene:RAX2 / 84839 HGNCID:18286 Length:184 Species:Homo sapiens


Alignment Length:344 Identity:88/344 - (25%)
Similarity:111/344 - (32%) Gaps:169/344 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 APSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTRE 116
            :|.......||...|          .|.|||:|.||.|||||::||.:||:||..:|||||::||
Human     4 SPGEGPATEGGGLGP----------GEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSRE 58

  Fly   117 ELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLG 181
            |||.|:.|.|.|:||||||||||||:||:           |..|:..:                 
Human    59 ELAAKVHLPEVRVQVWFQNRRAKWRRQER-----------LESGSGAV----------------- 95

  Fly   182 FQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLAN 246
                                    |||.:|        .||                        
Human    96 ------------------------AAPRLP--------EAP------------------------ 104

  Fly   247 MTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVG 311
                  ..|..:|||:               |.|..|..|             |.|.|.|.:|  
Human   105 ------ALPFARPPAM---------------SLPLEPWLG-------------PGPPAVPGLP-- 133

  Fly   312 VQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRR 376
                     .|:|                              |.|..||...|...|....|..
Human   134 ---------RLLG------------------------------PGPGLQASFGPHAFAPTFADGF 159

  Fly   377 TSSIAALRLKAREHELKLE 395
            ....|:|||.|:||...|:
Human   160 ALEEASLRLLAKEHAQALD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 35/51 (69%)
OAR 374..391 CDD:281777 7/16 (44%)
RAX2NP_001306003.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 12/38 (32%)
Homeobox 31..84 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085093at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.