DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Pax4

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_113987.1 Gene:Pax4 / 83630 RGDID:620433 Length:349 Species:Rattus norvegicus


Alignment Length:195 Identity:56/195 - (28%)
Similarity:79/195 - (40%) Gaps:55/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQN 135
            :|:|||..........|.||.|:..|.|.|||.|.|..|||...|.:||....|.|..::|||.|
  Rat   156 HSNCEAPRGPHPGTSHRNRTIFSPGQAEALEKEFQRGQYPDSVVRGKLAAATSLPEDTVRVWFSN 220

  Fly   136 RRAKWRKQEKVGPQSHPYNPYLPGGAATMQ----------------TVVGAALPP----NP-FTH 179
            ||||||:|||:     .:...:||.:..:.                :|..||||.    || |..
  Rat   221 RRAKWRRQEKL-----KWETQMPGASQDLMVPKDSPGIISAQQSPGSVPSAALPVLEQLNPSFCQ 280

  Fly   180 LGF--------------QLRKPFDAQH------AANLAAFRYPHLSAAPM---------IPSGYF 215
            |.:              ...:|:...|      :::...|.:|.|:..|:         .||.|:
  Rat   281 LCWGAVPDRCSSDTTSQACLQPYWECHSLLPVASSSYMEFAWPCLTTHPVHHLIGGPGQAPSTYY 345

  Fly   216  215
              Rat   346  345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 26/51 (51%)
OAR 374..391 CDD:281777
Pax4NP_113987.1 PAX 5..129 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131
Homeobox 174..226 CDD:278475 26/51 (51%)
Transcription repression 278..349 11/68 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.