DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Pax4

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_113987.1 Gene:Pax4 / 83630 RGDID:620433 Length:349 Species:Rattus norvegicus


Alignment Length:195 Identity:56/195 - (28%)
Similarity:79/195 - (40%) Gaps:55/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQN 135
            :|:|||..........|.||.|:..|.|.|||.|.|..|||...|.:||....|.|..::|||.|
  Rat   156 HSNCEAPRGPHPGTSHRNRTIFSPGQAEALEKEFQRGQYPDSVVRGKLAAATSLPEDTVRVWFSN 220

  Fly   136 RRAKWRKQEKVGPQSHPYNPYLPGGAATMQ----------------TVVGAALPP----NP-FTH 179
            ||||||:|||:     .:...:||.:..:.                :|..||||.    || |..
  Rat   221 RRAKWRRQEKL-----KWETQMPGASQDLMVPKDSPGIISAQQSPGSVPSAALPVLEQLNPSFCQ 280

  Fly   180 LGF--------------QLRKPFDAQH------AANLAAFRYPHLSAAPM---------IPSGYF 215
            |.:              ...:|:...|      :::...|.:|.|:..|:         .||.|:
  Rat   281 LCWGAVPDRCSSDTTSQACLQPYWECHSLLPVASSSYMEFAWPCLTTHPVHHLIGGPGQAPSTYY 345

  Fly   216  215
              Rat   346  345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 28/55 (51%)
OAR 374..391 CDD:461067
Pax4NP_113987.1 PAX 5..129 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131
Homeodomain 172..227 CDD:459649 28/54 (52%)
Transcription repression 278..349 11/68 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.