Sequence 1: | NP_722629.1 | Gene: | al / 33208 | FlyBaseID: | FBgn0000061 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113987.1 | Gene: | Pax4 / 83630 | RGDID: | 620433 | Length: | 349 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 56/195 - (28%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 55/195 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 NSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQN 135
Fly 136 RRAKWRKQEKVGPQSHPYNPYLPGGAATMQ----------------TVVGAALPP----NP-FTH 179
Fly 180 LGF--------------QLRKPFDAQH------AANLAAFRYPHLSAAPM---------IPSGYF 215
Fly 216 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
al | NP_722629.1 | Homeobox | 89..141 | CDD:278475 | 26/51 (51%) |
OAR | 374..391 | CDD:281777 | |||
Pax4 | NP_113987.1 | PAX | 5..129 | CDD:128645 | |
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 | 8..64 | ||||
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 | 83..131 | ||||
Homeobox | 174..226 | CDD:278475 | 26/51 (51%) | ||
Transcription repression | 278..349 | 11/68 (16%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |