DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Rhox13

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:195 Identity:53/195 - (27%)
Similarity:72/195 - (36%) Gaps:63/195 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EELPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPVSDGNSDC 74
            ||...||: |...|....:.|||  |.....|...|...|||| .|.:......:...|:.:|:.
Mouse    18 EETNAEAQ-AGAMAATSTEEAPG--AVEVAQAAVASSHDSGGA-IGCATVKESESDSESESDSES 78

  Fly    75 EAD------------------------------------------------------EYAPKRKQ 85
            |:|                                                      .|.|.|:.
Mouse    79 ESDSSDSSDESDDDSSTSDEDTSDPEEAAAPSVAAVAAAAAPPTVPAAAAIQIPGPYRYRPPRRH 143

  Fly    86 RRYRTT-----FTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK 145
            .|.|..     |..:|:||:|..|..|.|||:.||.|||..:.:.|.:::|||.|||||.||.|:
Mouse   144 VRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIER 208

  Fly   146  145
            Mouse   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 25/56 (45%)
OAR 374..391 CDD:281777
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 11/69 (16%)
Homeobox 155..204 CDD:278475 24/48 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.