Sequence 1: | NP_722629.1 | Gene: | al / 33208 | FlyBaseID: | FBgn0000061 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001171931.1 | Gene: | Rhox13 / 73614 | MGIID: | 1920864 | Length: | 232 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 53/195 - (27%) |
---|---|---|---|
Similarity: | 72/195 - (36%) | Gaps: | 63/195 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 EELPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPVSDGNSDC 74
Fly 75 EAD------------------------------------------------------EYAPKRKQ 85
Fly 86 RRYRTT-----FTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK 145
Fly 146 145 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
al | NP_722629.1 | Homeobox | 89..141 | CDD:278475 | 25/56 (45%) |
OAR | 374..391 | CDD:281777 | |||
Rhox13 | NP_001171931.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 45..114 | 11/69 (16%) | |
Homeobox | 155..204 | CDD:278475 | 24/48 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |