DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Isx

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001281207.1 Gene:Isx / 71597 MGIID:1918847 Length:242 Species:Mus musculus


Alignment Length:265 Identity:82/265 - (30%)
Similarity:105/265 - (39%) Gaps:109/265 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV 146
            |:.:||.|||||:.||:||||.|..|||||:..|.:||.:|.|.|||:|:||||:|||||||||.
Mouse    75 KKNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQEKS 139

  Fly   147 GPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIP 211
            |..|.|..   ||..|.              ||.                    |.::..:    
Mouse   140 GNLSAPQQ---PGSCAD--------------THC--------------------YDYIGTS---- 163

  Fly   212 SGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHML 276
                            |.|....|.|:.|:.:                       |...||..|.
Mouse   164 ----------------HRMLPTLSDSAPFKLV-----------------------PYTDSPCPMA 189

  Fly   277 ASPPTSPASGHASQHQQHPTA-----HPPPPQAPPQMPVGVQPAQLSPQHL----VG--IALTQQ 330
            ...||:||      ...||.:     |.|.|  .||  ||        |||    :|  .:|::|
Mouse   190 PMGPTAPA------WPSHPASLCPYLHVPTP--TPQ--VG--------QHLCNFNIGTDFSLSKQ 236

  Fly   331 ASSLS 335
            |:.||
Mouse   237 ATLLS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 33/51 (65%)
OAR 374..391 CDD:281777
IsxNP_001281207.1 Homeobox 82..134 CDD:278475 33/51 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.