DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Rhox13

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_001077350.3 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:210 Identity:55/210 - (26%)
Similarity:76/210 - (36%) Gaps:76/210 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGG---APSGA---SGASGGT------- 63
            :.|.....|....:..:....:...:...|.|.:|..||.   |.:||   |.||.||       
  Rat     1 MAQRVSFDHNYYFMECEEETNAGVQARAVASTSTMEASGAMAVAQAGAACRSHASRGTIGYDTVY 65

  Fly    64 -----NSPVSDGNSDCE----------------------------------------ADEYAP-- 81
                 ..|..:..||.|                                        |...||  
  Rat    66 EPNVKGDPKQESESDTEESYDDEDDDEDEGDEDDLSTSDQDTSDPEQEEAALFVAAAAPPIAPAA 130

  Fly    82 ------------KRKQRRYRTT----FTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQ 130
                        :|:.||:|.:    ||.:|:||:|..|..|.||||.||.|||..:.:.|.:::
  Rat   131 AAIQIPGPHRSRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYPDVLTRGELARTLNVPEVKVK 195

  Fly   131 VWFQNRRAKWRKQEK 145
            |||.|||||.||.|:
  Rat   196 VWFSNRRAKQRKNER 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 27/55 (49%)
OAR 374..391 CDD:281777
Rhox13XP_001077350.3 Homeobox 157..206 CDD:278475 26/48 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.