DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Rhox4a

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001034777.1 Gene:Rhox4a / 664609 MGIID:3580240 Length:205 Species:Mus musculus


Alignment Length:107 Identity:23/107 - (21%)
Similarity:39/107 - (36%) Gaps:25/107 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   790 EKHFVHRDLAARNILLAN-------------KYQAKISDFGLSRAI----GAGQEYY-----RAS 832
            :|.::.|.:::....||:             |.:..:..|||..||    ..|:||.     .:.
Mouse    79 KKEYITRQISSLKSALAHIIMPVNPYTGLPVKTKEALRVFGLGWAIILREKNGKEYIMRHADHSV 143

  Fly   833 QGGKWPIKWYAPESFNYGTFSHASDVWSFGVTLWEMFSYGAP 874
            ......:.||   ..|:...:..|.:..:|||...|..|..|
Mouse   144 NDTSVTVVWY---DKNWPHLATLSTLNLYGVTPLFMDQYLTP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649
OAR 374..391 CDD:461067
Rhox4aNP_001034777.1 homeodomain 129..187 CDD:238039 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.