DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Rhox10

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001032670.1 Gene:Rhox10 / 652926 RGDID:1563291 Length:201 Species:Rattus norvegicus


Alignment Length:76 Identity:31/76 - (40%)
Similarity:47/76 - (61%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQ 134
            |.:.|.::    .|:.:.::  ||..||.||||||..|.|||...|:.||..|.:.|.:::.||:
  Rat    83 GTAACRSN----NRQIKHHK--FTYAQLCELEKAFQETQYPDAHRRKALAALIHVDECKVKAWFK 141

  Fly   135 NRRAKWRKQEK 145
            |:|||:||:.|
  Rat   142 NKRAKYRKKHK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 25/51 (49%)
OAR 374..391 CDD:281777
Rhox10NP_001032670.1 Homeobox 99..148 CDD:278475 25/48 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.