DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and DRGX

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011538391.1 Gene:DRGX / 644168 HGNCID:21536 Length:298 Species:Homo sapiens


Alignment Length:365 Identity:98/365 - (26%)
Similarity:117/365 - (32%) Gaps:174/365 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GN-SDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQ--- 130
            || |..:.|:...:|||||.|||||..|||.||..|::||||||||||||||||.|||||:|   
Human    17 GNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQLAN 81

  Fly   131 --------------------------------VWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAAT 163
                                            ||||||||||||.|:......|           
Human    82 SCLKTELQIEINDTIIEHSEVEDHNFSLKGARVWFQNRRAKWRKTERGASDQEP----------- 135

  Fly   164 MQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPH 228
                 ||..|                                                       
Human   136 -----GAKEP------------------------------------------------------- 140

  Fly   229 GMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASG--HASQH 291
                           :|.:|         .||...:.||           ||...|..  .|.:.
Human   141 ---------------MAEVT---------PPPVRNINSP-----------PPGDQARSKKEALEA 170

  Fly   292 QQH--PTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQL 354
            ||.  .|..|..|..|..:|              |..|          .|:..|..|||....:.
Human   171 QQSLGRTVGPAGPFFPSCLP--------------GTLL----------NTATYAQALSHVASLKG 211

  Fly   355 PPPSHQAPPPPPRAATPP----EDRRTSSIAALRLKAREH 390
            .|......|.|...:..|    :..||:|:|.||:|||||
Human   212 GPLCSCCVPDPMGLSFLPTYGCQSNRTASVATLRMKAREH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 42/86 (49%)
OAR 374..391 CDD:281777 11/17 (65%)
DRGXXP_011538391.1 Homeobox 37..124 CDD:278475 42/86 (49%)
OAR 236..252 CDD:281777 11/16 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.