DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and pax8

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_001339893.5 Gene:pax8 / 60637 ZFINID:ZDB-GENE-001030-3 Length:448 Species:Danio rerio


Alignment Length:342 Identity:77/342 - (22%)
Similarity:118/342 - (34%) Gaps:103/342 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPQEAKLAHPDAVVLVDRA--PGSSAASAGAALTVSMS-VSGGAPSGASGASGGTNSPVSDGNSD 73
            ||.:.|...|...::...|  |..|..|.....|.|:: :.|...:.|.|..|       ..:||
Zfish   141 LPLDTKGLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGITQTTADGKRG-------HDDSD 198

  Fly    74 CEADEYA--------PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKI-------- 122
            .|:..::        ..|||.|..    .|....|:..|.|.:..|.|::.:...::        
Zfish   199 QESCRHSVDSQGSGGGARKQLRTE----HFPSAALDCGFERHYSSDSFSQSKAEQQLYPLALMNP 259

  Fly   123 GLTEARIQVWFQNRRAKWR----------------KQEKVGPQ--SHPYNPYLPGGAATMQTVVG 169
            ||.|.:.........|..:                ||| |.|:  |...:|::..|:|.:.  :.
Zfish   260 GLDEGKGASSISRNLAAHQGYAVVTEALQPLPLCLKQE-VSPEVNSLSPSPHIISGSAFLD--LS 321

  Fly   170 AALPPNP--------FTHL--GFQLRKPFDAQHAANLAAFRYPHLS-----AAPMIPSGYFNQFQ 219
            |...|:.        ..||  ||   ..| :.||.....|..|.|.     |:.|:| ||     
Zfish   322 AISSPSSAPVASSCGSAHLSHGF---SSF-SHHAPVHGQFSSPSLMAGREVASSMLP-GY----- 376

  Fly   220 RAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPR--GTPLGKPP------------ALLVGSPDLH 270
              ||| :|....|..|      |.:|.|.:.|.  |.....|.            :.::|||..:
Zfish   377 --PPH-IPTAQTGFSS------STIAGMVSAPEYTGQSYSHPAYSSYSEAWRFTNSSILGSPYYY 432

  Fly   271 SPNHMLASPPTSPASGH 287
            |.    |:.|..||:.:
Zfish   433 SS----ATRPPPPAAAY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 10/59 (17%)
OAR 374..391 CDD:281777
pax8XP_001339893.5 PAX 8..132 CDD:128645
Pax2_C 343..437 CDD:289189 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.