DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and pax4

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001232009.2 Gene:pax4 / 561564 ZFINID:ZDB-GENE-041210-244 Length:360 Species:Danio rerio


Alignment Length:183 Identity:56/183 - (30%)
Similarity:82/183 - (44%) Gaps:29/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK- 145
            :|...|.||.||:.|...|||.|:...|||:.|||:||.:..|::..|:|||.||||:.|::.| 
Zfish   175 RRTAHRSRTAFTADQSGRLEKEFTCGLYPDLLTREKLAEETNLSQDTIKVWFSNRRARMRRERKF 239

  Fly   146 ----VGPQSHPYNPYLPGGAATMQTVVGAAL-------PPNPFTHLGFQLRKPFDAQHAANLAAF 199
                .|.....:.........::.:..|.:|       .|:.|         |..||...|  .|
Zfish   240 EHNDCGIARRGFLGNCRNALISLSSTAGCSLDDYRAHHAPSAF---------PLAAQRDRN--TF 293

  Fly   200 RYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAG----MYSPSSSFQSLLANMT 248
            ...||: :..:.|..|:|.:...| |..||...    :.||:...:.||||.|
Zfish   294 PLAHLN-SNALSSCSFDQTESLMP-MCHHGNEALAYRLVSPNIDERILLANGT 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 26/51 (51%)
OAR 374..391 CDD:281777
pax4NP_001232009.2 PAX 15..139 CDD:128645
HOX 180..228 CDD:197696 23/47 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.