DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and drgx

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001032182.1 Gene:drgx / 560399 ZFINID:ZDB-GENE-070330-1 Length:287 Species:Danio rerio


Alignment Length:362 Identity:102/362 - (28%)
Similarity:135/362 - (37%) Gaps:141/362 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PSGASGASGGTNSPVSDG---NSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT 114
            |....|....||:..::|   ::..:.|:...:|||||.|||||..|||.||..|::|||||||.
Zfish     7 PPQLEGECCRTNTLNTNGFGNHASGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFA 71

  Fly   115 REELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPP----- 174
            ||||||||.|||||:|||||||||||||.|:...:.       .||...|    ....||     
Zfish    72 REELAMKINLTEARVQVWFQNRRAKWRKTERGTSEQ-------DGGKEQM----NEGNPPARNLN 125

  Fly   175 -NPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSS 238
             :|..| ....::|.:.|...|....     |..|..||            .||    |....::
Zfish   126 QSPVDH-SRSKKEPMELQQNINRVVG-----SGGPFFPS------------CLP----GTLLNTA 168

  Fly   239 SFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQ 303
            ::...|:.: |..:|:||                                               
Zfish   169 TYAQALSQV-ATLKGSPL----------------------------------------------- 185

  Fly   304 APPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRA 368
                                       .|...|   .|:.|:.       |||...|:       
Zfish   186 ---------------------------CSCCVP---DPMGLSF-------LPPYGCQS------- 206

  Fly   369 ATPPEDRRTSSIAALRLKAREH-ELKLELLRQNGHGN 404
                  .||:|:||||:||||| |..|:.....|.|:
Zfish   207 ------NRTASVAALRMKAREHSEAVLQSANLLGTGS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 41/51 (80%)
OAR 374..391 CDD:281777 12/17 (71%)
drgxNP_001032182.1 Homeobox 46..98 CDD:278475 41/51 (80%)
OAR 207..223 CDD:281777 11/15 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.